Pay in 4 interest-free payments of $32.53 Learn more
Ships within 48 hours · Estimated delivery Jul 31 - Aug 5
Phospho-TAB2 (Ser450) Antibody
although a variety of tissues produce the IGFs at distinctive times
KEKCGEERRKTRHFLDYLQEFLGVMSTEWAMEV
Catalogue Numbers: DF8391-100
In M phase
STAP2 Polyclonal Antibody-BS60284 SiRNA Transfection Phospho-TAB2 (Ser450) AntibodySTAP2 Polyclonal Antibody Catalogue Numbers: BS60284 50, BS60284 100 Sizes: 50l, 100l Alternative Name: Signal transducing adaptor protein 2; STAP 2; Breast tumor kinase substrate; BRK substrate; BKS Product: Rabbit IgG, 1mg ml in PBS with 0. 02% sodium azide, 50% glycerol, pH7. 2 Swiss Prot: Q9UGK3 Host: Rabbit Reactivity: Human, Mouse, Rat Applications: WB All Applications: WB: 1: 500~1: 1000 Background: STAP 2 is a protein that contains a